TICAM1 (TIR domain-containing adapter molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs).
It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter.
By genomic sequence analysis, Oshiumi et al.
(2003) mapped the TICAM1 gene to chromosome 19p13.3.
By coimmunoprecipitation analysis, Oshiumi et al.
(2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs.
Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3.
TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2.
Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes mouse TRIF.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide corresponding to aa53-84, QDTEARVSLESLKMNTVAQLVAHQWADMETTE, of mouse TRIF at N-terminal, different from the related human sequence by 12aa.
