Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids.
In humans, it is encoded by the TF gene.
Transferrin consists of a polypeptide chain containing 679aa in humans.
The protein is composed of alpha helices and beta sheets to form two domains.
The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site.
Transferrin is a glycoprotein that binds iron very tightly but reversibly.
Although iron bound to transferrin is less than 0.1% (4mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25mg/24h).
And Transferrin has a molecular weight of around 80kD and contains 2 specific high-affinity Fe(III) binding sites.
The affinity of transferrin for Fe(III) is extremely high (1023M−1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human Transferrin. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa20-49, VPDKTVRWCAVSEHEATKCQSFRDHMKSVI, of human Transferrin at N-terminal, different from the related mouse and rat sequences by 5aa.
