TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF- beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily.
A TGFBR2 cDNA encodes a deduced 565aa protein with a calculated molecular mass of ~60kD in length.
The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta.
This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors.
Alternatively spliced transcript variants encoding different informs have been characterized.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human TGFBR2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa96-128, TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK, of human TGFBR2 at N-terminal, different from the related mouse sequence by 5aa and from the related rat sequence by 8aa.
