84-4376-05 TGFBR1 (Transforming Growth Factor, Beta Receptor 1, AAT5, ALK 5, ALK5, ALK-5, MSSE, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF B Receptor I, TGF beta Receptor I, TGF beta Receptor Type 1, TGF beta Receptor Type I, TGF beta Type I Receptor, TGF-beta Receptor Type I, TGF-beta Receptor Type-1, TGF-beta Type I Receptor, TGFBR 1, TGFBR1 Protein, TGFR 1, TGFR1, TGFR-1) 100ug 353308
84-4376-05 TGFBR1 (Transforming Growth Factor, Beta Receptor 1, AAT5, ALK 5, ALK5, ALK-5, MSSE, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF B Receptor I, TGF beta Receptor I, TGF beta Receptor Type 1, TGF beta Receptor Type I, TGF beta Type I Receptor, TGF-beta Receptor Type I, TGF-beta Receptor Type-1, TGF-beta Type I Receptor, TGFBR 1, TGFBR1 Protein, TGFR 1, TGFR1, TGFR-1) 100ug 353308
Transforming growth factor, beta receptor I, is a TGF beta receptor.
TGFBR1 is its human gene.
The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm.
Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS).
TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1.
Both are transmembrane serine/threonine receptor kinases.
The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.
Vellucci and Reiss (1997) reported that the TGFBR1 gene is ~31kb long and contains 9 exons.
The organization of the segment of the gene that encodes the C- terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity:Recognizes human TGFBR1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa149-186, HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT, of human TGFBR1 at N-terminal.