Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene.
It is mapped to 2p25-p24.
This gene encodes one of two non-identical subunits for ribonucleotide reductase.
This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides.
Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion.
Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini.
Related pseudogenes have been identified on chromosomes 1 and X.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human RRM2. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa1-33, MLSLRVPLAPITDPQQLQLSPLKGLSLVDKEN, of human RRM2 at N-terminal, different from the related mouse and rat sequences by 8aa.
