EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2), also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene.
Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, the alpha subunit of eukaryotic protein synthesis initiation factor-2, leading to the inhibition of protein synthesis.
By FISH analysis, Squire et al.
(1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21.
Ben-Asouli et al.
(2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield.
IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region.
Taylor et al.
(1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon.
They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR.
E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human PKR.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa511-551, EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC of human PKR, different from the related mouse sequence by 15aa and from the related rat sequence by 13aa.
