Lck (or lymphocyte-specific protein tyrosine kinase) is a 56kD protein that is found inside specialized cells of the immune system called lymphocytes.
The human LCK gene is mapped to chromosome 1p35-p32.
This gene is a member of the Src family of protein tyrosine kinases (PTKs).
The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells.
It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine- containing and proline-rich motifs, respectively.
The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.
Multiple alternatively spliced variants, encoding the same protein, have been described.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human LCK. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa468-506, ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ, of human LCK at C-terminal, different from the related mouse and rat sequences by 3aa.
