Galectin-4 is a protein that in humans is encoded by the LGALS4 gene.
This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence.
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions.
LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer.
The 323aa LGALS4 protein contains 2 homologous, approximately 150aa carbohydrate recognition domains and all amino acids typically conserved in galectins.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human GAL4.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa283-320, DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY of human GAL4 at C-terminal, different from the related mouse and rat sequences by 7aa.
