FABP 2, Fatty acid-binding protein 2, is a protein that in humans is encoded by the FABP2 gene.
Using a human cDNA probe, the gene is assigned to chromosome 4 in somatic cell hybrids.
FABP 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells.
The FABPs belong to a multigene family with nearly twenty identified members.
And FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type.
They form 14-15kD proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids.
Also, they may be responsible in the modulation of cell growth and proliferation.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Specificity：Recognizes human Intestinal FABP. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa2-38, AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK, of human Intestinal FABP at N-terminal, different from the related mouse sequence by 7aa and from the related rat sequence by 6aa.
