Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene.
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases.
The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression.
Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle.
It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint.
It is regarded as a hub protein for the integration of epigenetic information.
This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target.
Multiple transcript variants encoding different isoforms have been found for this gene.
A related pseudogene exists on chromosome 12.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human UHRF1.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa14-51 HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ of human UHRF1 at N-terminal.
