84-4374-93 RPA1 (RPA70, Replication Protein A 70kD DNA-Binding Subunit, Replication Protein A, REPA1, RF-A Protein 1, RFA1, RPA 70, RP-A p70, RPA70, RPA-70) 100ug 353024
84-4374-93 RPA1 (RPA70, Replication Protein A 70kD DNA-Binding Subunit, Replication Protein A, REPA1, RF-A Protein 1, RFA1, RPA 70, RP-A p70, RPA70, RPA-70) 100ug 353024
Replication protein A 70kD DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene.
This gene is mapped to chromosome 17p13.3.
Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination.
It is composed of 70kD (RPA1), 32kD (RPA2), and 14kD (RPA3) subunits.
The RPA1 subunit is responsible for high-affinity ssDNA binding.
The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40.
It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex.
RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human RPA1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa533-568 QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANF of human RPA1 at C-terminal.