Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene.
This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminal and a RING finger domain at the C-terminal, and shows structural similarity to p53-binding protein MDM2.
Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers.
However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain.
This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation.
So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions.
Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human MDMX. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to aa35-72 KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQ of human MDMX at N-terminal.
