Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene.
This gene encodes a bifunctional signal transduction molecule.
Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor.
As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders.
Multiple transcript variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in Western Blot, mmunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5g/mlImmunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human DARPP32. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa1-36 MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA ofhuman DARPP32 at N-terminal.
