RELB (v-rel reticuloendotheliosis viral oncogene homolog B) is also known as IREL.
The International Radiation Hybrid Mapping Consortium assigned the RELB gene to chromosome 19.
By RT-PCR and immunocytochemical analyses, Clark et al.
(1999) showed that RELB expression correlated with dendritic cell activation.
NF-kappa-B-inducing kinase is required for osteoclastogenesis in response to pathologic stimuli.
Vaira et al.
(2008) found that overexpression of Relb, but not Rela, rescued differentiation of mouse Nik -/- osteoclast precursors, indicating that blockade of the alternative NF-kappa-B pathway, rather than the classical NF-kappa-B pathway, is responsible for the osteoclastogenic defect in the absence of Nik.
Using Relb -/- mice, they showed that Relb itself was required for Rankl-induced osteoclastogenesis in vitro and for TNF-induced bone resorption in vivo.
Both Relb -/- and Nik -/- mice were resistant to tumor-mediated osteolysis.
Vaira et al.
(2008) concluded that the alternative NF-kappa-B pathway, via RELB, plays an essential and unique role in RANKL signaling toward osteoclast development.
Applications:Suitable for use in Western Blot Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human Rel B.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa219-252, RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA, of human Rel B.