Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene.
It is a ubiquitously expressed protein with particularly high expression in the brain.
The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles.
Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development.
Mutations in this gene are associated with Warburg micro syndrome type 3.
Alternatively spliced transcript variants have been found for this gene.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human RAB18. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to aa156-192, DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSH- REE, of human RAB18 at C-terminal.
