84-4368-39 PDIA3, CT (ERp57, Protein disulfide-isomerase A3, Protein disulfide isomerase family A member 3, Disulfide Isomerase ER-60, Endoplasmic Reticulum Resident Protein 60, ER Protein 60, ERp60, 58kD Microsomal Protein, p58, Endoplasmic Reticulum Resident Protein 57, ER Protein 57, GRP58, Erp57, ER60) 100ug 350777
84-4368-39 PDIA3, CT (ERp57, Protein disulfide-isomerase A3, Protein disulfide isomerase family A member 3, Disulfide Isomerase ER-60, Endoplasmic Reticulum Resident Protein 60, ER Protein 60, ERp60, 58kD Microsomal Protein, p58, Endoplasmic Reticulum Resident Protein 57, ER Protein 57, GRP58, Erp57, ER60) 100ug 350777
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme.
It is mapped on 15q15.3.
PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface.
This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins.
The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity.
It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human PDIA3. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa471-505, RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL, of human PDIA3 at C-terminal.