PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family.
The PDGFA gene is mapped on 4q12.
The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib.
And the PDGFRA gene contains 23 exons spanning about 65kb.
Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al.
showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells.
PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family.
Lei et al.
noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB.
PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human PDGFRA. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa968-1002, DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKL- KD, of human PDGFRA at C-terminal.
