Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene.
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors.
The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator.
It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity.
Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers.
Multiple alternatively spliced variants, encoding the same protein, have been identified.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human SERPINI1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa272-310, KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDV- LKA L, of human SERPINI1 at C-terminal.
