5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene.
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK).
AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.
It is an important energy-sensing enzyme that monitors cellular energy status.
In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta- methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol.
This subunit may be a positive regulator of AMPK activity.
The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK.
This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human AMPK beta 1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa32-68, DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE, of human AMPK betA1 at N-terminal.
