Serine/threonine-protein kinase PAK 7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene.
The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases.
PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling.
This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP.
And this kinase is predominantly expressed in brain.
It is capable of promoting neurite outgrowth, and thus may play a role in neurite development.
In addition, this kinase is associated with microtubule networks and induces microtubule stabilization.
The subcellular localization of this kinase is tightly regulated during cell cycle progression.
Alternatively spliced transcript variants encoding the same protein have been described.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human PAK5. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa26-55, DPQEQKFTGLPQQWHSLLADTANRPKPMVD, of human PAK5 at N-terminal.
