MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-Delta or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene.
The protein encoded by this gene is a member of the MAP kinase family.
MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development.
This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress.
MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase.
Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human MAPK13. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa332-365, KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL, of human MAPK13 at C-terminal.
