GFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type- I domain.
IGFBP3 is located on chromosome 7.
The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II.
In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors.
Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Applications:Suitable for use in ELISA, Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/ml Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human IGFBP3. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：E IHC WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to aa214-252, RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYK- KKQCR, of human IGFBP3 at C-terminal.
