G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene.
It is mapped to 10q26.11.
This gene encodes a member of the guanine nucleotide- binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family.
The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation.
It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
Applications:Suitable for use in Western Blot, mmunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5Ug/ml Immunohistochemistry (paraffin): 0.5-1Ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human GRK5. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa393-429 KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5.
