FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragileX mentalretardation protein, or FMRP.
This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function.
Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits.
The protein encoded by this gene binds RNA and is associated with polysomes.
Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm.
A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome.
Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1).
Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
Applications:Suitable for use in Western Blot.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human FMRP. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa164-200, ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLS- LIM, of human FMRP at N-terminal.