Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene.
F2RL1 is a member of the large family of 7-transmembrane -region receptors that couple to guanosine-nucleotide-binding proteins.
F2RL1 is also a member of the protease-activated receptor family.
It is activated by trypsin, but not by thrombin.
It is activated by proteolytic cleavage of its extracellular amino terminus.
The new amino terminus functions as a tethered ligand and activates the receptor.
The F2RL1 gene contains two exons and is widely expressed in human tissues.
Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human PAR2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa349-383, HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHS- RKS, of human PAR2 at C-terminal.
