Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene.
It is found on chromosome 14q22-q23.
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily.
The superfamily includes large families of growth and differentiation factors.
Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site.
This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva.
Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Applications:Suitable for use in ELISA, Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/ml Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human BMP4. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：E WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to aa293-324, SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND, of human BMP4 at C-terminal.
