The protein encoded by this gene is a member of the Fe65 protein family.
It is an adaptor protein localized in the nucleus.
It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein.
APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation.
This encoded protein could play an important role in the pathogenesis of Alzheimer's disease.
It is thought to regulate transcription.
Also, it is observed to block cell cycle progression by downregulating thymidylate synthase expression.
Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human APBB1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa21-56, ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE, of human APBB1 at N-terminal.
