Matrix metallopeptidase 9 (MMP-9), also known as 92kD type IV collagenase, 92kD gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene.
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes.
Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.
The enzyme encoded by this gene degrades type IV and V collagens.
Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Applications:Suitable for use in ELISA, Western Blot.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/mlWestern Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human MMP9.
Isotype:IgG
Calc Applications Abbrev:E WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa633-667, WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVF- QY, of human MMP9 at C-terminal.