Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene.
This gene encodes a member of the galectin family.
Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains.
The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing.
This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.
Alternatively spliced transcript variants encoding different isoforms have been identified.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human Galectin 8. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to aa286-317, HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW, of human Galectin 8 at C-terminal.
