Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene.
It is mapped to 3q27.3.
The KNG1 gene uses alternative splicing to generate two different proteins – high – molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK).
HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system.
Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK.
In contrast to HMWK, LMWK is not involved in blood coagulation.
In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes mouse Kininogen-1.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide corresponding to aa227-259, ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L, of mouse Kininogen-1.
