Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene.
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.
This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment.
It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential.
It plays an essential role in T-cell proliferation and activation.
This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1.
And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes.
The apoptotic protein Bax has been suggested to insert into the outer mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue.
Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human KCNA3. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa513-544, EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ, of human KCNA3 at C-terminal.
