Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 minutes is required for staining formalin/parffin sections
Flow Cytometry: 1-3ug/1x10e6 cellsOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human Integrin alpha 4. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:FC IHC WB
Calc Crossreactivity:Hu Rt
Immunogen:Synthetic peptide corresponding to aa999-1028, MWKAGFFKRQYKSILQEENRRDSWSYINSK, at the C-Terminal of human Integrin alpha 4, different from the related mouse sequence by one amino acid