84-4367-07 HSP90AB1, CT (Hsp90 beta, Heat shock protein HSP 90-beta, Heat shock protein 90kD alpha (cytosolic) class B member 1, Heat shock 84kD) 100ug 350666
84-4367-07 HSP90AB1, CT (Hsp90 beta, Heat shock protein HSP 90-beta, Heat shock protein 90kD alpha (cytosolic) class B member 1, Heat shock 84kD) 100ug 350666
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene.
It is mapped to chromosome 6p21.1.
This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution.
And this gene is thought to play a role in gastric apoptosis and inflammation.
Alternative splicing results in multiple transcript variants.
Pseudogenes have been identified on multiple chromosomes.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human Hsp90 beta. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa449-481, RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK, of human Hsp90 beta at C-terminal.
