HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/ acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene.
The HDAC6 gene is mapped to chromosome Xp11.23.
HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other.
The protein possesses histone deacetylase activity and represses transcription.
HDAC6 functions as a tubulin deacetylase.
And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex.
HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes.
Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy- dependent manner.
HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human HDAC6. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Rt
Immunogen:Synthetic peptide corresponding to aa137-169, EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD, of human HDAC6 at N-terminal.