84-4366-96 GREM1, CT (Gremlin 1, Drm, Cysteine Knot Superfamily 1 BMP Antagonist 1, Increased in High Glucose Protein 2, IHG-2, Down-regulated in Mos-transformed Cells Protein, DAN Domain Family Member 2, Cell Proliferation-inducing Gene 2 Protein GREM1, CKTSF1B1, DAND2) 100ug 350642
84-4366-96 GREM1, CT (Gremlin 1, Drm, Cysteine Knot Superfamily 1 BMP Antagonist 1, Increased in High Glucose Protein 2, IHG-2, Down-regulated in Mos-transformed Cells Protein, DAN Domain Family Member 2, Cell Proliferation-inducing Gene 2 Protein GREM1, CKTSF1B1, DAND2) 100ug 350642
Gremlin, also known as Drm, is a highly conserved 20.7kD, 184aa glycoprotein part of the DAN family and is a cysteine knot-secreted protein.
Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists.
And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro.
Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway.
This gene inhibits BMP-2, BMP-4, and BMP-7.
Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development.
Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma.
Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67).
Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human Gremlin 1. Species Crossreactivity: rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Rt
Immunogen:Synthetic peptide corresponding to aa151-184, TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD, of human Gremlin 1 at C-terminal.