p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene.
Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome.
It is a 754aa protein identified as a member of the NBS1/ hMre11/ RAD50 (N/M/R, more commonly referred to asMRN) double strand DNA break repair complex.
This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci.
It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human Nibrin. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa714-745, RKNTELEEWLRQEMEVQNQHAKEESLADDLFR, of human Nibrin at C-terminal.
