IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene.
The IGFBP1 gene has 4 exons and spans 5.9kb.
And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization.
This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain.
The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma.
Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Applications:Suitable for use in ELISA, Western Blot.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/mlWestern Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes mouse IGFBP1. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：E WB
Calc Crossreactivity：Mo Rt
Immunogen：Synthetic peptide corresponding to aa177-207, REIADLKKWKEPCQRELYKVLERLAAAQQKA, of mouse IGFBP1 at C-terminal.
