Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11.
FABP1 encodes the fatty acid binding protein found in liver.
Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules.
FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids.
It is thought that FABPs roles include fatty acid uptake, transport, and metaboism.
The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1cM of Ly-2.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human liver FABP. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa6-36, KYQLQSQENFEAFMKAIGLPEELIQKGKDIK, of human liver FABP at N-terminal.
