84-4366-33 STAT1, NT (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, STAT1alpha, STAT1b, Signal Transducer And Activator Of Transcription 1 91kD) 100ug 350839
84-4366-33 STAT1, NT (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84, STAT1alpha, STAT1b, Signal Transducer And Activator Of Transcription 1 91kD) 100ug 350839
The crystal structure of the DNA complex of a 67kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution.
Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes.
The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections.
Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.
Applications:Suitable for use in Western Blot, Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity:Recognizes human STAT1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa114-143, KILENAQRFNQAQSGNIQSTVMLDKQKELD, of human STAT1 at N-terminal.