Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy.
The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1.
Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.
Applications:Suitable for use in Immunocytochemistry, Flow Cytometry, Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml Requires HIER using sodium citrate buffer pH6.0 prior to staining
Immunohistochemistry (Frozen): 0.5-1ug/mlImmunocytochemistry: 0.5-1ug/mlFlow Cytometry: 1-3ug/10e6Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes human ATXN2. Species Crossreactivity: mouse and rat.
Isotype：IgG
Calc Applications Abbrev：FC IC IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa1283-1313, QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2 at C-terminal.
