Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene.
The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2.
It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described.
The enzyme degrades soluble and insoluble elastin.
It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema.
This gene may involved in tissue injury and remodeling.
Applications:Suitable for use in ELISA, Western Blot.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/mlWestern Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Specificity：Recognizes mouse MMP12.
Isotype：IgG
Calc Applications Abbrev：E WB
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide corresponding to aa432-466, KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK, of mouse MMP12 at C-terminal.
