Applications:Suitable for use in Immunofluorescence and ELISA.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 1:200-1:1000ELISA: 1:10,000Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, 0.5% BSA, 0.02% sodium azide, 50% glycerol.
Specificity:Human
Isotype:IgG
Calc Applications Abbrev:E IF
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa30-110 TANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGER of the N-terminal region of human TGR5.