MaxLight™ 550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection.
Zinc is an essential cofactor for hundreds of enzymes.
It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.
SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications have not been tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™550 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity:Recognizes human SLC39A6. Species Crossreactivity: bovine, canine, guinea pig, equine, mouse, rat, sheep
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Bo Ca Eq Gp Hu Mo Rt Sh
Immunogen:Synthetic peptide corresponding to the middle region, RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN, of human SLC39A6.