84-3713-91 ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 550) 100ul 137542-ML550
84-3713-91 ANXA2 (Annexin A2, Annexin II, Annexin-2, Calpactin I Heavy Chain, Calpactin-1 Heavy Chain, Chromobindin-8, Lipocortin II, Placental Anticoagulant Protein IV, PAP-IV, Protein I, p36, ANX2, ANX2L4, CAL1H, LPC2D) (MaxLight 550) 100ul 137542-ML550
MaxLight™ 550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection.
Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways.
This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption.
ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively.
Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™550 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity:Recognizes Annexin A2. Species Crossreactivity: Human, mouse and canine.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Ca Hu Mo
Immunogen:C-terminus of ANXA2 corresponding to a RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD