MaxLight™ 490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane.
SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex.
It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER.
The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway.
SEC63 is an integral membrane protein located in the rough ER.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™490 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Specificity:Recognizes SEC63. Species Crossreactivity: Human, mouse and canine.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Ca Hu Mo
Immunogen:Synthetic peptide corresponding to a WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS