MaxLight™ 490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors.
The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C-terminal domain.
The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.
Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors.
The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C-terminal domain.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 2.5ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™490 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Specificity:Recognizes NR2C2. Species Crossreactivity: Human, mouse, rat and canine.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Ca Hu Mo Rt
Immunogen:C-terminus of NR2C2 corresponding to AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS