84-3703-74 [取扱停止]RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (MaxLight 405) 100ul 138287-ML405
84-3703-74 [取扱停止]RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (MaxLight 405) 100ul 138287-ML405
MaxLight™ 405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30kD, the so-called Rh30 polypeptides.
Heterogeneously glycosylated membrane proteins of 50 and 45kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies.
The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™405 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™405.
Specificity:Recognizes human RHAG.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Middle region of RHAG corresponding to FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG