Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins.
Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways.
The annexin VI gene is approximately 60kbp long and contains 26 exons.
It encodes a protein of about 68kD that consists of eight 68aa repeats separated by linking sequences of variable lengths.
It is highly similar to human annexins I and II sequences, each of which contain four such repeats.
Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6aa insertion at the start of the seventh repeat.
Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity:Recognizes human Annexin A6.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:C-terminus of ANXA6 corresponding to SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK