Component C2 is part of the classical pathway of complement system.
Activated C1 cleaves C2 into C2a and C2b.
C2a leads to activation of C3.
Deficiency of C2 has been reported to associated with certain autoimmune diseases.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilutions:Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes human C2.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ of human CO2. Species sequence homology: bovine, canine, equine, mouse, rabbit, rat, sheep and porcine