RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells.
Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region.
Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer.
Its gene may play a role in malignancies and disease that involve this region.
Applications:Suitable for use in ELISA and Western Blot.
Other applications have not been tested.
Recommended Dilutions:Optimal dilutions to be determined by researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile ddH2O or PBS.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity：Recognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish.
Isotype：IgG
Calc Applications Abbrev：E WB
Calc Crossreactivity：Ce Ca Hu Mo Rt Ze
Immunogen：Synthetic peptide from near the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL)
